Mouse Anti-Zebrafish e2f5 Antibody (CBMOAB-74330FYA)


Cat: CBMOAB-74330FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO74330FYA
SpecificityThis antibody binds to Zebrafish e2f5.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish e2f5 (clone MO74330FYA) Antibody (CBMOAB-74330FYA) is a mouse antibody against e2f5. It can be used for e2f5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namese2f5
UniProt IDA5WUE8
Protein RefseqThe length of the protein is 363 amino acids long.
The sequence is show below: MAESNSASFPHSTPNGSSRHEKSLGLLTVKFVTLLQEAKDGVLDLKVAADSLAVKQKRRIYDITNVLEGIGLIEKKTKNTIQWKGESTGCQPQEVLEQVELLKANIADLELQERELDMQKACLQQSIKQLNEDPYSCRYSYVMHEDICDAFSGDTLLAVMAPSGTQLEVPVPEMGHNGQKKYQVNLRSHSAPIQVMLINRETSCSKPVVVSVPPIDDISSMPTPPSTPAGLQRFPISSIDLCDQKHGLLKSPAAEHQLTPSSTSPDVHMECNPESPASQCLLMQSSLGGPEEQQRELGGQDLQSMLEEMRDEREGVSNLIDELMSSDVFPLLRLSPNPGVDYSFNLDDNEGVCDLFDVQILNY.
For Research Use Only | Not For Clinical Use.

Online Inquiry