Mouse Anti-Zebrafish eno2 Antibody (CBMOAB-75019FYA)


Cat: CBMOAB-75019FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO75019FYA
SpecificityThis antibody binds to Zebrafish eno2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Product OverviewMouse Anti-Zebrafish eno2 (clone MO75019FYA) Antibody (CBMOAB-75019FYA) is a mouse antibody against eno2. It can be used for eno2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameseno2; Enolase 2
UniProt IDF6NUZ4
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: MSVVSIIAREILDSRGNPTVEVDLRTDKGLFRAAVPSGASTGIYEALELRDGDKSRYNGKGVLKAVGHINDTLGPAIIASIRFRSDGIRIRSHPCTF.
For Research Use Only | Not For Clinical Use.

Online Inquiry