Mouse Anti-Zebrafish ethe1 Antibody (CBMOAB-75414FYA)


Cat: CBMOAB-75414FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO75414FYA
SpecificityThis antibody binds to Zebrafish ethe1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the metallo beta-lactamase family of iron-containing proteins involved in the mitochondrial sulfide oxidation pathway. The encoded protein catalyzes the oxidation of a persulfide substrate to sulfite. Certain mutations in this gene cause ethylmalonic encephalopathy, an infantile metabolic disorder affecting the brain, gastrointestinal tract and peripheral vessels. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Zebrafish ethe1 Antibody is a mouse antibody against ethe1. It can be used for ethe1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:85680; ethe1; zgc:8568
UniProt IDQ6NWI8
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: MSSALLNRLKPAVSSALRLWSSRPTIPPGLSLRYAASVRLYSGLMEPAAPLFRQLFESESCTYTYLLADPDTREAVLIDPVLETVDRDLQLIQQLGLNLTVALNTHCHADHITGTGLLKKKVFGLKSGISKHSGAAADIQLSDGDSITFGKHCLMVRETPGHTDGCVTYVTGDQRMAFTGDALLIRGCGRTDFQQGSPHRLYESVHQKIFSLPGHCFIYPAHDYKGQTVSTVDEEKKFNPRLTKTVEEFVKIMDNLNLPKPKKIDISVPANLVCGLHDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry