Mouse Anti-Zebrafish fgb Antibody (CBMOAB-76365FYA)


Cat: CBMOAB-76365FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO76365FYA
SpecificityThis antibody binds to Zebrafish fgb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish fgb Antibody is a mouse antibody against fgb. It can be used for fgb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFibrinogen, B beta polypeptide; fg
UniProt IDQ6NYE1
Protein RefseqThe length of the protein is 485 amino acids long.
The sequence is show below: MKLVLLLCLCAVGALAQDDYDDYGEGKKEAKEVVDPRGHRPVSRGRETYSPGPVSQPPISGGTRYRGRPTAAPVGKAVQEKEEQPESGGCNHMSEKMGVLCPTGCELKKALIKQERNVKPTVEQLKRAVDDLTQSTNSIHGYVLDMTAEVAQRQKVSEGNGLVVDQYTDSLETQHAYIKDTVDVTFPQNIKVLQGVLDKIREKIQRLEKAITTQRAKCQAPCKVTCPIPVVSGKECEDIIRKGGEDSQMYIIRPDPLGTPYKVFCDQTSKNGGWVLIQNRMDGSVDFGRRWDDYRRGFGNIAFDVGKGHCQTPGEYWLGNDRISQLSKMGATELLVEMEDWSGSKVYAQYEQFSMQGEASNYILGVGRYSGTAGNTFLEGATELFGENRTMTIHNGMMFSTYDRDNDKWIPGDPSKQCSKEDGGGWWYNRCHSCNPNGRYYWGGAYTKYMAKHGTDDGIVWMNWKGSWYSLKTISMKIRPYFKQK.
For Research Use Only | Not For Clinical Use.
Online Inquiry