AibGenesis™ Mouse Anti-gpr65 Antibody (CBMOAB-78527FYA)


Cat: CBMOAB-78527FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-78527FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Horse (Equus caballus), Marmoset WB, ELISA MO78527FYA 100 µg
MO-AB-13309R Monoclonal Cattle (Bos taurus) WB, ELISA MO13309R 100 µg
MO-AB-44933W Monoclonal Horse (Equus caballus) WB, ELISA MO44933W 100 µg
MO-AB-56298W Monoclonal Marmoset WB, ELISA MO56298W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Horse (Equus caballus), Marmoset
CloneMO78527FYA
SpecificityThis antibody binds to Zebrafish gpr65.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish gpr65 Antibody is a mouse antibody against gpr65. It can be used for gpr65 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesgpr65; XP_005169846.1
UniProt IDE7FCG9
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: MNVTDSWISFSTQSNESKDCYPPAHPERKIFVALHLTVILIGIPSNIFFLFVSYRLIRQKNELGVYLFNLALSDLLFITCLPVWIEFALNDQWLHGEAACTVCVFLLFTYFYTSIVLLSCIAVDRYLAIVHPLKFSTFRKRRIALSLSVAAWIFALVFNAITVDLNGVYDEENKVCLDVYLSHKQKWANVTRFVVGFLIPALVVGFCYWRICSDIKNNQTLRSMELQHVFKLLVCVLLTLYLCFGPVHIMMVLKVLLESCPHPSWLFFAYKTSVFLATLNCLADPLLYGFTSRTGKDSASGMLLILRRAWRKETQTETVQHNEHINGTAMLSNDKSPI.
For Research Use Only | Not For Clinical Use.
Online Inquiry