Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Zebrafish ly75 Antibody (CBMOAB-85627FYA)


Cat: CBMOAB-85627FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO85627FYA
SpecificityThis antibody binds to Zebrafish ly75.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD205 also called Lymphocyte antigen 75 is a protein that in humans is encoded by the LY75 gene.
Product OverviewMouse Anti-Zebrafish ly75 (clone MO85627FYA) Antibody (CBMOAB-85627FYA) is a mouse antibody against ly75. It can be used for ly75 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:dkey-78p20.2 protein; ly75; im:7150926 si:dkey-78p20.
UniProt IDQ58EG8
Protein RefseqThe length of the protein is 330 amino acids long.
The sequence is show below: VSYRRVAKKLNWYQALQECGSNGGHLASITDKTTNENMALIAKRDGFSLWIGLSKQDVSRWPFEWSDGTAVKFKTDGFEDDGDDSEEKCVFIDSTGNWSAVNCHATQQGAICYNHLNEGTSDRFSKSSSSCPKSDGQSSWVLFKDHCYNFNTYNFSVFTMDDAKNVCQTLDSSSNLLTIKSKEENDFVSDYINKNPSITSRVWLALIVDAKGNPTGWQDGSELDFSSWDLSNSKAQHSLDGTQLCAVMLSSSGSWTQASCSNSRSRVVCKAPAHPGTPVALIFFIIIVLILAAAVGFILYQKNKHRFHSPVRYQRNFDDADSTSMINDAD.
For Research Use Only | Not For Clinical Use.

Online Inquiry