AibGenesis™ Mouse Anti-Zebrafish mapk14b Antibody (CBMOAB-85954FYA)


Cat: CBMOAB-85954FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO85954FYA
SpecificityThis antibody binds to Zebrafish mapk14b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSerine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Mapk14b is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additional targets. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish mapk14b Antibody is a mouse antibody against mapk14b. It can be used for mapk14b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitogen-activated protein kinase 14; mapk14b; MAPK1
UniProt IDQ6TNT1
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MSQKARPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCSAFDSKAGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFSPATSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRALKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLVSRTDHIDQLKLIMMLVGTPGPELLMKISSESARNYISSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITASQALAHPYFAQYHDPDDEPEADPYDQSFESRDLEIEEWKSLTYEEVVSFEPPVFDGDEMES.
For Research Use Only | Not For Clinical Use.
Online Inquiry