AibGenesis™ Mouse Anti-pfdn4 Antibody (CBMOAB-92263FYA)
Cat: CBMOAB-92263FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-92263FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO92263FYA | 100 µg | ||
| MO-AB-01052L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01052L | 100 µg | ||
| MO-AB-02935W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02935W | 100 µg | ||
| MO-AB-06754Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06754Y | 100 µg | ||
| MO-AB-11160W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11160W | 100 µg | ||
| MO-AB-17795R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17795R | 100 µg | ||
| MO-AB-27821H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27821C | 100 µg | ||
| MO-AB-28214R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28214R | 100 µg | ||
| MO-AB-32675W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO32675W | 100 µg | ||
| MO-AB-33589H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33589C | 100 µg | ||
| MO-AB-61344W | Monoclonal | Marmoset | WB, ELISA | MO61344W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO92263FYA |
| Specificity | This antibody binds to Zebrafish pfdn4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish pfdn4 Antibody is a mouse antibody against pfdn4. It can be used for pfdn4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Prefoldin subunit 4; pfdn4; si:dkey-222e15. |
| UniProt ID | F1R0Z8 |
| Protein Refseq | The length of the protein is 135 amino acids long. The sequence is show below: MAATMKKGVAAEDVNVTFEDQQKINKFARNTNRMSELKDEIEAKKKSLQNLEDASDDLMMCEDDSMLIPYQIGDVFISHSQEETQEMLEAAKEALQEEIKALEGRVSSIQGVLGDLKVQLYAKFGNNINLEADES. |
For Research Use Only | Not For Clinical Use.
Online Inquiry