Mouse Anti-rhoh Antibody (CBMOAB-95940FYA)


Cat: CBMOAB-95940FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95940FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO95940FYA 100 µg
MO-AB-17483Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17483Y 100 µg
MO-AB-19278R Monoclonal Cattle (Bos taurus) WB, ELISA MO19278R 100 µg
MO-AB-28487H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28487C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO95940FYA
SpecificityThis antibody binds to Zebrafish rhoh.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the Ras superfamily of guanosine triphosphate (GTP)-metabolizing enzymes. The encoded protein is expressed in hematopoietic cells, where it functions as a negative regulator of cell growth and survival. This gene may be hypermutated or misexpressed in leukemias and lymphomas. Chromosomal translocations in non-Hodgkin's lymphoma occur between this locus and B-cell CLL/lymphoma 6 (BCL6) on chromosome 3, leading to the production of fusion transcripts. Alternative splicing in the 5' untranslated region results in multiple transcript variants that encode the same protein. (From NCBI)
Product OverviewMouse Anti-Zebrafish rhoh Antibody is a mouse antibody against rhoh. It can be used for rhoh detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesrhoh; Ras Homolog Family Member H
UniProt IDF1R1D2
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MNGLTETSVKCVLVGDCAVGKTALLVRFTSETFPDSYRPTVYENTGVDVFMDGIQISLGLWDTAGHDTFRQIRPMSYQDTDVVLLCYSVANPSSLNNLRHKWIAEVREYLPKVPVLVVATQTDHREMGPYRANCTTSPEGKQVAQEIRAKGYLECSALSNRGVQQVFECAVRTAVNRARRQTRRRLLNLNPCKIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry