AibGenesis™ Mouse Anti-rph3al Antibody (CBMOAB-96384FYA)


Cat: CBMOAB-96384FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-96384FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO96384FYA 100 µg
MO-AB-07216H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07216C 100 µg
MO-AB-19467R Monoclonal Cattle (Bos taurus) WB, ELISA MO19467R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO96384FYA
SpecificityThis antibody binds to Zebrafish rph3al.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene plays a direct regulatory role in calcium-ion-dependent exocytosis in both endocrine and exocrine cells and plays a key role in insulin secretion by pancreatic cells. This gene is likely a tumor suppressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. (From NCBI)
Product OverviewMouse Anti-Zebrafish rph3al Antibody is a mouse antibody against rph3al. It can be used for rph3al detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesrph3al; Rabphilin 3A Like (Without C2 Domains)
UniProt IDB8K0F3
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: MTDTMFGSENEQWVCPNDRQLMLRAKLHTGWSIHTFQSERQRKAQALEKRELDLIMSVIHRAEQLELIEQHRIGRLVERLDNMRSSAMGNGLSQCLLCGEVFGLLGSSSVLCLDCCM.
For Research Use Only | Not For Clinical Use.
Online Inquiry