Cat: CBMOAB-00004FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio) |
Clone | MO00004FYB |
Specificity | This antibody binds to Zebrafish si:ch211-226h8.14. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Zebrafish si:ch211-226h8.14 (clone MO00004FYB) Antibody (CBMOAB-00004FYB) is a mouse antibody against si:ch211-226h8.14. It can be used for si:ch211-226h8.14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Rhamnose-binding lectin; si:ch211-226h8.1 |
UniProt ID | Q0H0S1 |
Protein Refseq | The length of the protein is 41 amino acids long. The sequence is show below: TDRKTCIKNRPPHQIRNTNCRSSSSLSIVSSWCDGRQSCNV. |
See other products for " si:ch211-226h8.14 "
For Research Use Only | Not For Clinical Use.