Mouse Anti-Zebrafish si:ch211-226h8.4 Antibody (CBMOAB-00006FYB)


Cat: CBMOAB-00006FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO00006FYB
SpecificityThis antibody binds to Zebrafish si:ch211-226h8.4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish si:ch211-226h8.4 (clone MO00006FYB) Antibody (CBMOAB-00006FYB) is a mouse antibody against si:ch211-226h8.4. It can be used for si:ch211-226h8.4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:ch211-226h8.4 protein; si:ch211-226h8.
UniProt IDA8WFV0
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: MVSLSLVLTLILLNSSLLISASGGHYGHGHGHGGHDHDDDHDYDYCRRSSKTVNACEGSILRLSCPGCKIRILAANYGRTDRKTCIKNRPPHQIRNTNCRSSSSLSIVSSWCDGRQSCNVPATNSVFSDPCYGTYKYLRVKYCCTRRRS.
For Research Use Only | Not For Clinical Use.

Online Inquiry