Mouse Anti-Zebrafish tmsb Antibody (CBMOAB-10101FYB)
Cat: CBMOAB-10101FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio) |
| Clone | MO10101FYB |
| Specificity | This antibody binds to Zebrafish tmsb. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytoskeleton; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity). |
| Product Overview | Mouse Anti-Zebrafish tmsb Antibody is a mouse antibody against tmsb. It can be used for tmsb detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Thymosin beta; tms |
| UniProt ID | Q9W7M8 |
| Protein Refseq | The length of the protein is 45 amino acids long. The sequence is show below: MADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry