Mouse Anti-Zebrafish tmsb Antibody (CBMOAB-10101FYB)
Cat: CBMOAB-10101FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio) |
Clone | MO10101FYB |
Specificity | This antibody binds to Zebrafish tmsb. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytoskeleton; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-Zebrafish tmsb Antibody is a mouse antibody against tmsb. It can be used for tmsb detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Thymosin beta; tms |
UniProt ID | Q9W7M8 |
Protein Refseq | The length of the protein is 45 amino acids long. The sequence is show below: MADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry