AibGenesis™ Mouse Anti-trappc1 Antibody (CBMOAB-08074FYB)


Cat: CBMOAB-08074FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08074FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Ye, Marmoset WB, ELISA MO08074FYB 100 µg
MO-AB-08683H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08683C 100 µg
MO-AB-22119R Monoclonal Cattle (Bos taurus) WB, ELISA MO22119R 100 µg
MO-AB-25834W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25834W 100 µg
MO-AB-29739H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29739C 100 µg
MO-AB-66824W Monoclonal Marmoset WB, ELISA MO66824W 100 µg
MO-DKB-03460W Polyclonal Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Ye, Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Ye, Marmoset
CloneMO08074FYB
SpecificityThis antibody binds to Zebrafish trappc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a variety of xenobiotic and endogenous compounds, including dopamine, T3 (triiodo-L-thyronine), T4 (thyroxine), flavonoids, isoflavonoids, and other phenolic compounds. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish trappc1 Antibody is a mouse antibody against trappc1. It can be used for trappc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTrafficking protein particle complex 1; trappc
UniProt IDQ800X2
Protein RefseqThe length of the protein is 296 amino acids long.
The sequence is show below: MTVHNLYIFDRNGTCLHYSEWNRKKQAGISKEEEFKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQTNRYKLHYYETPTGIRLVMNTDLSAPNCRETLQQIYSTLYVDLIVKNPLCVLGESLQSELFNSKLDSFIRALPFFSVRAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry