Mouse Anti-Zebrafish usp14 Antibody (CBMOAB-15499FYB)


Cat: CBMOAB-15499FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO15499FYB
SpecificityThis antibody binds to Zebrafish usp14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewMouse Anti-Zebrafish usp14 Antibody is a mouse antibody against usp14. It can be used for usp14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquitin carboxyl-terminal hydrolase; EC 3.4.19.12; usp1
UniProt IDQ803B3
Protein RefseqThe length of the protein is 489 amino acids long.
The sequence is show below: MPVFTVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPERQKVMVKGGTLKDDEWGNIKLKNGMTLLMMGSADALPEEPVVRPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCLRSVPELKGALRRYSGALRSSGANAPSQYITAALRDLYESMDKTSSSIPPIILLQFLHMAFPQFAEKGDQGQYLQQDANECWVQVMRVLQQKLEPQEPETPMETDGDSAAAASTKKKSFIDQYFGVEFETSMKCTEAEDEEPTKGTESQLQLSCFINQEVKYLATGLRLRLQEDITKFSPSLQRNALYIKSSKISRLPAYHTVQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTSELQEKMVSLRSKFKEMEDKKLEKQQKSEPNKKPGALKETKYEPFSFPDDLGSNNSGYYELQAVLTHQGRSSSSGHYVAWVKRKEDEWVKFDDDKVSVVTPEDILKLSGGGDWHIAYVLLYGPRRLEMLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry