AibGenesis™ Mouse Anti-ZNF211 Antibody (CBMOAB-63007FYA)


Cat: CBMOAB-63007FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63007FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO63007FYA 100 µg
Inquiry
MO-AB-07112W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07112W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO63007FYA
SpecificityThis antibody binds to Rhesus ZNF211.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing a Kruppel-associated box domain and multiple zinc finger domains. This protein may play a role in developmental processes. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF211 Antibody is a mouse antibody against ZNF211. It can be used for ZNF211 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF211
UniProt IDF7GH58
Protein RefseqThe length of the protein is 609 amino acids long.
The sequence is show below: MATALRDPAPVPIATEVLFKLTQGSVTFEDVAVYFSWEEWDLLDEAQKHLYFDVMLENFALTSSLGLTSSWSHVVAQLGLGEVSSVLPRMFMTPASARWDQREPGLHEWHLGKGMSSGCWHGVEHEETPSEQRISVEGVPQFRTSKEGSSSQNAYSCEICGLVLRDILHLAEHQGTNCGQKLHTYGKQFYINANLQQHQRQHIKEAPFTSYVDTTSFTKSCTVHVSEKPFTCREIRKDFLANMRFLHQEATQTGEKPNNSNKCVVAFYSGKSHRNWGKYSKAFSHTDTLVQDQRILTREGLFECSKCGKACTRRCNLIQHQKVHSEERPYECNECGKFFTYYSSFIIHQRVHTGERPYVCPECGKSFSQIYSLNSHRKVHTGERPYECSECGKSFSQRSNLMQHRRVHTGERPYECSECGKSFSQNFSLIYHQRVHTGERPHECNECGKSFSRSSSLIHHRRLHTGERPYECSKCGKSFKQSSSFSSHRKVHTGERPYVCGECGKSFSHSSNLKNHQRVHTGERPVECSECSKSFSCKSNLIKHLRVHTGERPYECSECGKSFSQSSSLIQHRRVHTGKRPYQCSECGKSFGCKSVLIQHQRVHIGEKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry