Cat: CBMOAB-0004YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ) |
Clone | MO0004YC |
Specificity | This antibody binds to Escherichia coli K-12 aaeX. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-E. coli aaeX (clone MO0004YC) Antibody (CBMOAB-0004YC) is a mouse antibody against aaeX. It can be used for aaeX detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein AaeX; aaeX; yhcR; b3242 JW5541 |
UniProt ID | P46478 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFYLISRLFV. |
For Research Use Only | Not For Clinical Use.