Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-E. coli abgB Antibody (CBMOAB-0008YC)


Cat: CBMOAB-0008YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0008YC
SpecificityThis antibody binds to Escherichia coli K-12 abgB.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the p-aminobenzoyl-glutamate hydrolase multicomponent enzyme system which catalyzes the cleavage of p-aminobenzoyl-glutamate (PABA-GLU) to form p-aminobenzoate (PABA) and glutamate. AbgAB does not degrade dipeptides and the physiological role of abgABT should be clarified.
Product OverviewMouse Anti-E. coli abgB (clone MO0008YC) Antibody (CBMOAB-0008YC) is a mouse antibody against abgB. It can be used for abgB detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative Namesp-aminobenzoyl-glutamate hydrolase subunit B; EC 3.5.1.-; PABA-GLU hydrolase; PGH; abgB; ydaI; b1337 JW1331
UniProt IDP76052
Protein RefseqThe length of the protein is 481 amino acids long. The sequence is show below: MQEIYRFIDDAIEADRQRYTDIADQIWDHPETRFEEFWSAEHLASALESAGFTVTRNVGNIPNAFIASFGQGKPVIALLGEYDALAGLSQQAGCAQPTSVTPGENGHGCGHNLLGTAAFAAAIAVKKWLEQYGQGGTVRFYGCPGEEGGSGKTFMVREGVFDDVDAALTWHPEAFAGMFNTRTLANIQASWRFKGIAAHAANSPHLGRSALDAVTLMTTGTNFLNEHIIEKARVHYAITNSGGISPNVVQAQAEVLYLIRAPEMTDVQHIYDRVAKIAEGAALMTETTVECRFDKACSSYLPNRTLENAMYQALSHFGTPEWNSEELAFAKQIQATLTSNDRQNSLNNIAATGGENGKVFALRHRETVLANEVAPYAATDNVLAASTDVGDVSWKLPVAQCFSPCFAVGTPLHTWQLVSQGRTSIAHKGMLLAAKTMAATTVNLFLDSGLLQECQQEHQQVTDTQPYHCPIPKNVTPSPLK.
For Research Use Only | Not For Clinical Use.

Online Inquiry