Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-E. coli accB Antibody (CBMOAB-0013YC)


Cat: CBMOAB-0013YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0013YC
SpecificityThis antibody binds to Escherichia coli K-12 accB.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.
Product OverviewMouse Anti-E. coli accB (clone MO0013YC) Antibody (CBMOAB-0013YC) is a mouse antibody against accB. It can be used for accB detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesBiotin carboxyl carrier protein of acetyl-CoA carboxylase; BCCP; accB; fabE; b3255 JW3223
UniProt IDP0ABD8
Protein RefseqThe length of the protein is 156 amino acids long. The sequence is show below: MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE.
For Research Use Only | Not For Clinical Use.

Online Inquiry