Mouse Anti-E. coli acpP Antibody (CBMOAB-0025YC)


Cat: CBMOAB-0025YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0025YC
SpecificityThis antibody binds to Escherichia coli K-12 acpP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCarrier of the growing fatty acid chain in fatty acid biosynthesis.
Product OverviewMouse Anti-E. coli acpP Antibody is a mouse antibody against acpP. It can be used for acpP detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl carrier protein; ACP; Cytosolic-activating factor; CAF; Fatty acid synthase acyl carrier protein; acpP; b1094 JW1080
UniProt IDP0A6A8
Protein RefseqThe length of the protein is 78 amino acids long. The sequence is show below: MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA.
See other products for " ACPP "
MO-AB-10098WMouse Anti-Chimpanzee ACPP Antibody (MO-AB-10098W)
CBMOAB-34985FYAMouse Anti-Rhesus ACPP Antibody (CBMOAB-34985FYA)
MO-AB-06916RMouse Anti-Cattle ACPP Antibody (MO-AB-06916R)
MO-AB-09581HMouse Anti-Malaria parasite acpP Antibody (MO-AB-09581H)
MO-AB-50350WMouse Anti-Marmoset ACPP Antibody (MO-AB-50350W)
MO-AB-23492RMouse Anti-Pig ACPP Antibody (MO-AB-23492R)
For Research Use Only | Not For Clinical Use.
Online Inquiry