Cat: CBMOAB-0025YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ) |
Clone | MO0025YC |
Specificity | This antibody binds to Escherichia coli K-12 acpP. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
Product Overview | Mouse Anti-E. coli acpP (clone MO0025YC) Antibody (CBMOAB-0025YC) is a mouse antibody against acpP. It can be used for acpP detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acyl carrier protein; ACP; Cytosolic-activating factor; CAF; Fatty acid synthase acyl carrier protein; acpP; b1094 JW1080 |
UniProt ID | P0A6A8 |
Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA. |
See other products for " ACPP "
MO-AB-23492R | Mouse Anti-Pig ACPP Antibody (MO-AB-23492R) |
CBMOAB-34985FYA | Mouse Anti-Rhesus ACPP Antibody (CBMOAB-34985FYA) |
CBMOAB-34986FYA | Mouse Anti-Rhesus ACPP Antibody (CBMOAB-34986FYA) |
MO-AB-10098W | Mouse Anti-Chimpanzee ACPP Antibody (MO-AB-10098W) |
CBMOAB-34983FYA | Mouse Anti-Rhesus ACPP Antibody (CBMOAB-34983FYA) |
MO-AB-50350W | Mouse Anti-Marmoset ACPP Antibody (MO-AB-50350W) |
CBMOAB-34984FYA | Mouse Anti-Rhesus ACPP Antibody (CBMOAB-34984FYA) |
MO-AB-09581H | Mouse Anti-Malaria parasite acpP Antibody (MO-AB-09581H) |
MO-AB-06916R | Mouse Anti-Cattle ACPP Antibody (MO-AB-06916R) |
MO-AB-50351W | Mouse Anti-Marmoset ACPP Antibody (MO-AB-50351W) |
For Research Use Only | Not For Clinical Use.