Mouse Anti-E. coli acpS Antibody (CBMOAB-0026YC)


Cat: CBMOAB-0026YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0026YC
SpecificityThis antibody binds to Escherichia coli K-12 acpS.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTransfers the 4'-phosphopantetheine moiety from coenzyme A to the 'Ser-36' of acyl-carrier-protein.
Product OverviewMouse Anti-E. coli acpS (clone MO0026YC) Antibody (CBMOAB-0026YC) is a mouse antibody against acpS. It can be used for acpS detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesHolo-[acyl-carrier-protein] synthase; Holo-ACP synthase; EC 2.7.8.7; 4'-phosphopantetheinyl transferase AcpS; acpS; dpj; b2563 JW2547
UniProt IDP24224
Protein RefseqThe length of the protein is 126 amino acids long. The sequence is show below: MAILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIWKTHHQPVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVANMHVTLADERHYACATVIIES.
For Research Use Only | Not For Clinical Use.

Online Inquiry