Cat: CBMOAB-0034YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ) |
Clone | MO0034YC |
Specificity | This antibody binds to Escherichia coli K-12 acrZ. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | AcrA-AcrB-AcrZ-TolC is a drug efflux protein complex with a broad substrate specificity. This protein binds to AcrB and is required for efflux of some but not all substrates, suggesting it may influence the specificity of drug export. |
Product Overview | Mouse Anti-E. coli acrZ (clone MO0034YC) Antibody (CBMOAB-0034YC) is a mouse antibody against acrZ. It can be used for acrZ detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Multidrug efflux pump accessory protein AcrZ; AcrAB-TolC multidrug efflux pump accessory protein AcrZ; Acridine resistance protein Z; acrZ; ybhT; b0762 JW5102 |
UniProt ID | P0AAW9 |
Protein Refseq | The length of the protein is 49 amino acids long. The sequence is show below: MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH. |
For Research Use Only | Not For Clinical Use.