Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-E. coli acrZ Antibody (CBMOAB-0034YC)


Cat: CBMOAB-0034YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0034YC
SpecificityThis antibody binds to Escherichia coli K-12 acrZ.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAcrA-AcrB-AcrZ-TolC is a drug efflux protein complex with a broad substrate specificity. This protein binds to AcrB and is required for efflux of some but not all substrates, suggesting it may influence the specificity of drug export.
Product OverviewMouse Anti-E. coli acrZ (clone MO0034YC) Antibody (CBMOAB-0034YC) is a mouse antibody against acrZ. It can be used for acrZ detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesMultidrug efflux pump accessory protein AcrZ; AcrAB-TolC multidrug efflux pump accessory protein AcrZ; Acridine resistance protein Z; acrZ; ybhT; b0762 JW5102
UniProt IDP0AAW9
Protein RefseqThe length of the protein is 49 amino acids long. The sequence is show below: MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH.
For Research Use Only | Not For Clinical Use.

Online Inquiry