Mouse Anti-E. coli adk Antibody (CBMOAB-0048YC)


Cat: CBMOAB-0048YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0048YC
SpecificityThis antibody binds to Escherichia coli K-12 adk.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Product OverviewMouse Anti-E. coli adk (clone MO0048YC) Antibody (CBMOAB-0048YC) is a mouse antibody against adk. It can be used for adk detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase; AK; EC 2.7.4.3; ATP-AMP transphosphorylase; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; adk; dnaW plsA; b0474 JW0463
UniProt IDP69441
Protein RefseqThe length of the protein is 214 amino acids long. The sequence is show below: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG.
For Research Use Only | Not For Clinical Use.

Online Inquiry