Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-E. coli agaB Antibody (CBMOAB-0056YC)


Cat: CBMOAB-0056YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0056YC
SpecificityThis antibody binds to Escherichia coli K-12 agaB.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in N-acetylgalactosamine transport.
Product OverviewMouse Anti-E. coli agaB (clone MO0056YC) Antibody (CBMOAB-0056YC) is a mouse antibody against agaB. It can be used for agaB detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-acetylgalactosamine-specific phosphotransferase enzyme IIB component 1; EC 2.7.1.69; EIIB-Aga; PTS system N-acetylgalactosamine-specific EIIB component 1; agaB; yraD; b3138 JW3107
UniProt IDP42909
Protein RefseqThe length of the protein is 158 amino acids long. The sequence is show below: MTSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFGIRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD.
For Research Use Only | Not For Clinical Use.

Online Inquiry