Cat: CBMOAB-0086YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ) |
| Clone | MO0086YC |
| Specificity | This antibody binds to Escherichia coli K-12 alpA. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Positive regulator of the expression of the slpA gene (PubMed:7511582). When overexpressed, leads to suppression of the capsule overproduction and UV sensitivity phenotypes of cells mutant for the Lon ATP-dependent protease (PubMed:7511582). Part of the cryptic P4-like prophage CP4-57 (PubMed:7511583). Overexpression of AlpA leads to excision of the CP4-57 prophage by IntA. This inactivates ssrA (the gene upstream of the prophage) that encodes tmRNA which is required to rescue stalled ribosomes in a process known as trans-translation (PubMed:7511583). |
| Product Overview | Mouse Anti-E. coli alpA (clone MO0086YC) Antibody (CBMOAB-0086YC) is a mouse antibody against alpA. It can be used for alpA detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Prophage CP4-57 regulatory protein AlpA; alpA; alp; b2624 JW2604 |
| UniProt ID | P33997 |
| Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: MNNRSAVRILRLPAVIQKTGMARATIYDWLNPKSPRYDATFPKKRMLGVKSVGWIEAEIDEWLSQRCKLI. |
For Research Use Only | Not For Clinical Use.