Cat: CBMOAB-0118YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ) |
| Clone | MO0118YC |
| Specificity | This antibody binds to Escherichia coli K-12 appX. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Might be part of cytochrome bd-II oxidase (appB and appC). Able to restore reductant resistance to a cydX deletion mutant upon overexpression. CydX and this protein may have some functional overlap. |
| Product Overview | Mouse Anti-E. coli appX (clone MO0118YC) Antibody (CBMOAB-0118YC) is a mouse antibody against appX. It can be used for appX detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative cytochrome bd-II ubiquinol oxidase subunit AppX; appX; yccB; b4592 JW0961.1 |
| UniProt ID | P24244 |
| Protein Refseq | The length of the protein is 30 amino acids long. The sequence is show below: MWYLLWFVGILLMCSLSTLVLVWLDPRLKS. |
For Research Use Only | Not For Clinical Use.