Mouse Anti-ssb Antibody (CBMOAB-2643YC)
Cat: CBMOAB-2643YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-2643YC | Monoclonal | E. coli (Escherichia coli ), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO2643YC | 100 µg | ||
CBMOAB-41814FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO41814FC | 100 µg | ||
MO-AB-11748W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11748W | 100 µg | ||
MO-AB-43458W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43458W | 100 µg | ||
MO-AB-46696W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46696W | 100 µg | ||
MO-AB-65387W | Monoclonal | Marmoset | WB, ELISA | MO65387W | 100 µg | ||
MO-AB-20931R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20931R | 100 µg | ||
MO-AB-08032H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08032C | 100 µg | ||
MO-AB-29220H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29220C | 100 µg | ||
MO-AB-10096Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10096Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
Clone | MO2643YC |
Specificity | This antibody binds to Escherichia coli K-12 ssb. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism. Acts as a sliding platform that migrates on DNA via reptation. SSB or its 10 C-terminal amino acids stimulates the ATPase activity of RadD (PubMed:27519413). (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-E. coli ssb Antibody is a mouse antibody against ssb. It can be used for ssb detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Single-stranded DNA-binding protein; SSB; Helix-destabilizing protein; ssb; exrB lexC; b4059 JW4020 |
UniProt ID | P0AGE0 |
Protein Refseq | The length of the protein is 178 amino acids long. The sequence is show below: MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF. |
See other products for " ssb "
CBMOAB-07436FYB | Mouse Anti-ssb Antibody (CBMOAB-07436FYB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry