Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans ARL8 Antibody (CBMOAB-00626HCB)


Cat: CBMOAB-00626HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00626HB
SpecificityThis antibody binds to C. elegans ARL8.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans ARL8 (clone MO00626HB) Antibody (CBMOAB-00626HCB) is a mouse antibody against ARL8. It can be used for ARL8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNovel small G protein indispensable for equal chromosome segregation; Protein ARL-8; arl-8 gie
Gene ID178405
UniProt IDG5EDC6
Protein RefseqThe length of the protein is 185 amino acids long. The sequence is show below: MLAMVNKVLDWIRSLFWKEEMELTLVGLQNSGKTTFVNVIASGQFTEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVFMVDAADEEKLEASRNELMQLLDKPQLDAIPVLVLGNKKDLPGALDERQLIERMNLSSIQNREICCYSISCKEKENIDITLQWLIDHSKAQR.
For Research Use Only | Not For Clinical Use.

Online Inquiry