Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans CES1 Antibody (CBMOAB-00006HCB)


Cat: CBMOAB-00006HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00006HB
SpecificityThis antibody binds to C. elegans CES1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.
Product OverviewMouse Anti-C. elegans CES1 (clone MO00006HB) Antibody (CBMOAB-00006HCB) is a mouse antibody against CES1. It can be used for CES1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCEll death Specification; ces-1
Gene ID185718
UniProt IDG5ECN8
Protein RefseqThe length of the protein is 270 amino acids long. The sequence is show below: MITTPNISLTPTVAPPVDFPIIGNCDFQAQLWHLMSLHLQMQKSSAASTSSSSSSSTSSENLKKSPSSVQNTSVFSIDNILNSQKVPKLELENDEDVSSSPSPTCSTTGYTLDSLQNLDRRSLNKKGPSSHNRCVCDKCGKSYATTSNLSRHKQTHRALDSPHAKQCPHCDRVYVSMPALSMHILTHNASHECNVCGKRFSRLWLLQGHLRSHTGLRPFSCAHCGKSFADRSNLRAHMLTHTGDKRFECDKCGRRFALRAYLNRHLETCK.
For Research Use Only | Not For Clinical Use.

Online Inquiry