Mouse Anti-ACACA Antibody (MO-AB-06827R)


Cat: MO-AB-06827R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06827R Monoclonal Cattle (Bos taurus), Goat (Capra hircus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO06827R 100 µg
CBMOAB-34909FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34909FYA 100 µg
CBMOAB-64542FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64542FYA 100 µg
MO-AB-36654W Monoclonal Goat (Capra hircus) WB, ELISA MO36654W 100 µg
MO-AB-14061Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14061Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Goat (Capra hircus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO06827R
SpecificityThis antibody binds to Cattle ACACA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAcetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5'' sequence and encoding distinct isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle ACACA Antibody is a mouse antibody against ACACA. It can be used for ACACA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcetyl-CoA carboxylase 1; ACACA
UniProt IDE1BGH6
Protein RefseqThe length of the protein is 2346 amino acids long.
The sequence is show below: MDEPSSLAKPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVSSDTLSDLGISSLQDGLALHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry