Mouse Anti-Cattle AMN Antibody (MO-AB-07305R)


Cat: MO-AB-07305R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07305R
SpecificityThis antibody binds to Cattle AMN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a type I transmembrane protein. It is thought to modulate bone morphogenetic protein (BMP) receptor function by serving as an accessory or coreceptor, and thus facilitates or hinders BMP binding. It is known that the mouse AMN gene is expressed in the extraembryonic visceral endoderm layer during gastrulation, but it is found to be mutated in amnionless mouse. The encoded protein has sequence similarity to short gastrulation (Sog) and procollagen IIA proteins in Drosophila.
Product OverviewMouse Anti-Cattle AMN Antibody is a mouse antibody against AMN. It can be used for AMN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAmnionless homolog; Mouse; AMN
UniProt IDQ3T152
Protein RefseqThe length of the protein is 462 amino acids long.
The sequence is show below: MGAPGLVLLWLQLCALTPAAYKVWVPNTNFDDATNWSQNRPPCAGAAVEFPADKTLSVLVREGHSISDMLLPLDGEFVLASGAGFGAADAGSRPDCGPGARARFLDPDRFLWLDPRLWRPGDAGRGLFSVDAERVPCRHDDVVFPADASFRVGLGPGAGTVRVRSVQALGQTFARDEDLTAFLASRAGRLRFHGPGALSVDLEACADPSGCVCGNAEAQPWICAALLQPLGGGCPQAACLEPLRPEGQCCDLCGA.
For Research Use Only | Not For Clinical Use.
Online Inquiry