Mouse Anti-Asta Antibody (CBMOAB-01307FYA)


Cat: CBMOAB-01307FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01307FYA Monoclonal Fruit fly (Drosophila melanogaster), E. coli (Escherichia coli ) WB, ELISA MO01307FYA 100 µg
CBMOAB-0200YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0200YC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), E. coli (Escherichia coli )
CloneMO01307FYA
SpecificityThis antibody binds to fruit fly Asta.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay act as a neurotransmitter or neuromodulator.
Product OverviewMouse Anti-D. melanogaster Asta Antibody is a mouse antibody against Asta. It can be used for Asta detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAllatostatin-A; Allatostatins Ast; [Cleaved into: Drostatin-1; Drostatin-2; Drostatin-3; Drostatin-4; Drostatin-5]; AstA; Ast
UniProt IDQ9VC44
Protein RefseqThe length of the protein is 151 amino acids long.
The sequence is show below: MNSLHAHLLLLAVCCVGYIASSPVIGQDQRSGDSDADVLLAADEMADNGGDNIDKRVERYAFGLGRRAYMYTNGGPGMKRLPVYNFGLGKRSRPYSFGLGKRSDYDYDQDNEIDYRVPPANYLAAERAVRPGRQNKRTTRPQPFNFGLGRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry