Mouse Anti-D. melanogaster Eif5 Antibody (CBMOAB-16108FYA)


Cat: CBMOAB-16108FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO16108FYA
SpecificityThis antibody binds to fruit fly Eif5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]).
Product OverviewMouse Anti-D. melanogaster Eif5 Antibody is a mouse antibody against Eif5. It can be used for Eif5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 5; eIF-5; eIF5
UniProt IDQ9VXK6
Protein RefseqThe length of the protein is 464 amino acids long.
The sequence is show below: MATVNVNRSVTDIFYRYKMPRLQAKVEGKGNGIKTVLVNMAEVARAIGRPATYPTKYFGCELGAQTLFDHKNERFVVNGSHDVNKLQDLLDGFIRKFVLCPECDNPETNLTVSAKNQTISQSCKACGFHGLLKVNHKVNTFIVKNPPSLNPAAQGSSLTEGKRSRKQKQKNDNADGSMTNNSLANNSGGESDGGNGTNQASQTEAEISAAIPEKTAKDDDDEGWSVDVSKEAIRARLQDLTDGAKGMTISDDYDKTEKERIDIFYELVKDKRDKKQLDDVQTHKELVIEAERLDIINKAPLVLAELLFTENIIKDVQKNRPLLLRFTLNNPKAQRYLIGGVEQTVELHKGILMSKVAGIFKLFYDLDILDEAVILEWAQKVSKRHVSKNIAAEIHEKAMPFVLWLKNAEEESSESEEEEDDESEEDNYVSSAGQRGGQRVVQRGIPRAVAGDEDDEDDVNIDDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry