Mouse Anti-Lsm7 Antibody (CBMOAB-23329FYA)


Cat: CBMOAB-23329FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23329FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) WB, ELISA MO23329FYA 100 µg
Inquiry
CBMOAB-36028FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36028FC 100 µg
Inquiry
CBMOAB-49302FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO49302FYA 100 µg
Inquiry
CBMOAB-85576FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85576FYA 100 µg
Inquiry
CBMOAB-02111CR Monoclonal Yeast WB, ELISA MO02111CR 100 µg
Inquiry
CBMOAB-06194HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06194HB 100 µg
Inquiry
MO-AB-11409W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11409W 100 µg
Inquiry
MO-AB-58436W Monoclonal Marmoset WB, ELISA MO58436W 100 µg
Inquiry
MO-AB-04933H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04933C 100 µg
Inquiry
MO-AB-26861H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26861C 100 µg
Inquiry
MO-AB-11995Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11995Y 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio)
CloneMO23329FYA
SpecificityThis antibody binds to fruit fly Lsm7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 snRNP, spliceosomal U4/U6.U5 snRNP, and free U6 snRNP). It binds directly to the U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. It probably also is involved in degradation of nuclear pre-mRNA by targeting them for decapping. LSM7 binds specifically to the 3''-terminal U-tract of U6 snRNA. LSM2-LSM8 probably is involved in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. LSM7, probably in a complex that contains LSM2-LSM7 but not LSM1 or LSM8, associates with the precursor of the RNA component of RNase P (pre-P RNA) and may be involved in maturing pre-P RNA.
Product OverviewMouse Anti-D. melanogaster Lsm7 Antibody is a mouse antibody against Lsm7. It can be used for Lsm7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG13277-PA; LSm7, isoform B; LSm7, isoform C; RH73529p; LSm7
UniProt IDQ9VJI7
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: MADKKVGGNNDGKEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGVESIANPFITQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry