Mouse Anti-Rat Med8 Antibody (MO-AB-27044H)
Cat: MO-AB-27044H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rat (Rattus norvegicus) |
| Clone | MO27044C |
| Specificity | This antibody binds to Rat Med8. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein component of the mediator complex, which aids in transcriptional activation through interaction with RNA polymerase II and gene-specific transcription factors. The encoded protein may also function in ubiquitin ligation and protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Product Overview | This product is a mouse antibody against Med8. It can be used for Med8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mediator of RNA polymerase II transcription, subunit 8 homolog (Yeast), isoform CRA_a; Protein Med8; Med8 |
| UniProt ID | D3ZM37 |
| Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: MAHVTYLSFLEVHSRENAKWNKNQHQVSFNASLPAVSVDGSLHSQVICAELSNEIIFCSRLI. |
See other products for " MED8 "
| MO-AB-23431H | Mouse Anti-Mallard MED8 Antibody (MO-AB-23431H) |
| MO-AB-04374W | Mouse Anti-Rhesus MED8 Antibody (MO-AB-04374W) |
| CBMOAB-86470FYA | Mouse Anti-Zebrafish med8 Antibody (CBMOAB-86470FYA) |
| CBMOAB-02223CR | Mouse Anti-Yeast MED8 Antibody (CBMOAB-02223CR) |
| MO-AB-58949W | Mouse Anti-Marmoset MED8 Antibody (MO-AB-58949W) |
| MO-AB-12060Y | Mouse Anti-O. mykiss MED8 Antibody (MO-AB-12060Y) |
| MO-AB-13917Y | Mouse Anti-Sea-anemone MED8 Antibody (MO-AB-13917Y) |
| CBMOAB-36378FYC | Mouse Anti-Arabidopsis MED8 Antibody (CBMOAB-36378FYC) |
| CBMOAB-51114FYA | Mouse Anti-Rhesus MED8 Antibody (CBMOAB-51114FYA) |
| MO-AB-35116W | Mouse Anti-Ferret MED8 Antibody (MO-AB-35116W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry