Mouse Anti-Med8 Antibody (MO-AB-27044H)
Cat: MO-AB-27044H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-27044H | Monoclonal | Rat (Rattus norvegicus), A. thaliana (Arabidopsis thaliana), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Sea-anemone, Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO27044C | 100 µg | ||
| CBMOAB-36378FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO36378FC | 100 µg | ||
| CBMOAB-23595FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO23595FYA | 100 µg | ||
| CBMOAB-51114FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51114FYA | 100 µg | ||
| CBMOAB-86470FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO86470FYA | 100 µg | ||
| CBMOAB-02223CR | Monoclonal | Yeast | WB, ELISA | MO02223CR | 100 µg | ||
| MO-AB-04374W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04374W | 100 µg | ||
| MO-AB-43267W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43267W | 100 µg | ||
| MO-AB-58949W | Monoclonal | Marmoset | WB, ELISA | MO58949W | 100 µg | ||
| MO-AB-23431H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23431C | 100 µg | ||
| MO-AB-12060Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12060Y | 100 µg | ||
| MO-AB-13917Y | Monoclonal | Sea-anemone | WB, ELISA | MO13917Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rat (Rattus norvegicus), A. thaliana (Arabidopsis thaliana), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Mallard (Anas platyrhynchos), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Sea-anemone, Yeast, Zebrafish (Danio rerio) |
| Clone | MO27044C |
| Specificity | This antibody binds to Rat Med8. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein component of the mediator complex, which aids in transcriptional activation through interaction with RNA polymerase II and gene-specific transcription factors. The encoded protein may also function in ubiquitin ligation and protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Product Overview | This product is a mouse antibody against Med8. It can be used for Med8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mediator of RNA polymerase II transcription, subunit 8 homolog (Yeast), isoform CRA_a; Protein Med8; Med8 |
| UniProt ID | D3ZM37 |
| Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: MAHVTYLSFLEVHSRENAKWNKNQHQVSFNASLPAVSVDGSLHSQVICAELSNEIIFCSRLI. |
See other products for " MED8 "
| MO-AB-35116W | Mouse Anti-MED8 Antibody (MO-AB-35116W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry