Mouse Anti-ACE Antibody (MO-AB-00905W)


Cat: MO-AB-00905W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00905W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human, Mouse, Bovine, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Silkworm (Bombyx mori), Zebrafish (Danio rerio) WB, ELISA MO00905W 100 µg
CBMOAB-00537FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO00537FYA 100 µg
CBMOAB-64621FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64621FYA 100 µg
MO-AB-27162W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27162W 100 µg
MO-AB-43553W Monoclonal Horse (Equus caballus) WB, ELISA MO43553W 100 µg
MO-AB-68743W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO68743W 100 µg
MO-AB-06874R Monoclonal Cattle (Bos taurus) WB, ELISA MO06874R 100 µg
MO-AB-23958H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23958C 100 µg
MO-AB-00021Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00021Y 100 µg
MO-AB-07056Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07056Y 100 µg
MO-AB-14064Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14064Y 100 µg
MOFAB-095W Monoclonal Human, Mouse, Bovine ELISA, IHC, FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human, Mouse, Bovine, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Silkworm (Bombyx mori), Zebrafish (Danio rerio)
CloneMO00905W
SpecificityThis antibody binds to Rhesus ACE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, and two most abundant spliced variants encode the somatic form and the testicular form, respectively, that are equally active.
Product OverviewMouse Anti-Rhesus ACE Antibody is a mouse antibody against ACE. It can be used for ACE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAngiotensin-converting enzyme isoform 2; ACE
UniProt IDH9F3E6
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: HASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSHEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHVPSSVPYIRYFISFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHQSLHQHPQGPQFGSEVELRHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry