Mouse Anti-Rhesus CYB5R3 Antibody (CBMOAB-40198FYA)


Cat: CBMOAB-40198FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40198FYA
SpecificityThis antibody binds to Rhesus CYB5R3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYB5R3 (Cytochrome B5 Reductase 3) is a Protein Coding gene. Diseases associated with CYB5R3 include Methemoglobinemia Due To Deficiency Of Methemoglobin Reductase and Hereditary Methemoglobinemia. Among its related pathways are Innate Immune System and Metabolism. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and NAD binding. An important paralog of this gene is CYB5R1.
Product OverviewMouse Anti-Rhesus CYB5R3 Antibody is a mouse antibody against CYB5R3. It can be used for CYB5R3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYB5R3
UniProt IDF6XXH0
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: PGGVKGSGLTRPRGHRDDLWPSVTPFCPAGQHIYLSAQIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSNPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTLDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF.
See other products for " cyb5r3 "
MO-AB-02774HMouse Anti-Frog cyb5r3 Antibody (MO-AB-02774H)
MO-AB-08614WMouse Anti-Cat CYB5R3 Antibody (MO-AB-08614W)
CBMOAB-72536FYAMouse Anti-Zebrafish cyb5r3 Antibody (CBMOAB-72536FYA)
MO-AB-29976WMouse Anti-Dog CYB5R3 Antibody (MO-AB-29976W)
MO-AB-24998RMouse Anti-Pig CYB5R3 Antibody (MO-AB-24998R)
MO-AB-53799WMouse Anti-Marmoset CYB5R3 Antibody (MO-AB-53799W)
MO-AB-21093WMouse Anti-Chimpanzee CYB5R3 Antibody (MO-AB-21093W)
MO-AB-11001RMouse Anti-Cattle CYB5R3 Antibody (MO-AB-11001R)
MO-AB-41498WMouse Anti-Guinea pig CYB5R3 Antibody (MO-AB-41498W)
For Research Use Only | Not For Clinical Use.
Online Inquiry