Mouse Anti-COQ5 Antibody (CBMOAB-22310FYB)


Cat: CBMOAB-22310FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22310FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Maize (Zea mays), O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) WB, ELISA MO22310FYB 100 µg
CBMOAB-26427FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO26427FC 100 µg
CBMOAB-13767FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO13767FYA 100 µg
CBMOAB-39737FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO39737FYA 100 µg
CBMOAB-71341FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71341FYA 100 µg
CBMOAB-00793CR Monoclonal Yeast WB, ELISA MO00793CR 100 µg
CBMOAB-02095HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO02095HB 100 µg
MO-AB-02391W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02391W 100 µg
MO-AB-03553W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03553W 100 µg
MO-AB-10888W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10888W 100 µg
MO-AB-27495W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27495W 100 µg
MO-AB-34613W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34613W 100 µg
MO-AB-43022W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43022W 100 µg
MO-AB-47824W Monoclonal Maize (Zea mays) WB, ELISA MO47824W 100 µg
MO-AB-10587R Monoclonal Cattle (Bos taurus) WB, ELISA MO10587R 100 µg
MO-AB-01000H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO01000C 100 µg
MO-AB-01352Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01352Y 100 µg
MO-AB-11029Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11029Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Maize (Zea mays), O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio)
CloneMO22310FYB
SpecificityThis antibody binds to Rice COQ5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOQ5 (Coenzyme Q5, Methyltransferase) is a Protein Coding gene. Among its related pathways are Ubiquinol biosynthesis and Metabolism. Gene Ontology (GO) annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity.
Product OverviewMouse Anti-Rice COQ5 Antibody is a mouse antibody against COQ5. It can be used for COQ5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; EC 2.1.1.201; Ubiquinone biosynthesis methyltransferase COQ5; COQ5; Os01g0976600 LOC_Os01g74520
UniProt IDQ5JNC0
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: MALRSAAGRLASSSRRRLLSPPTSIHTAFLHSHATSFGYKQVAEEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFPGMKHLDVAGGTGDVAFRALERINSVSHRAMQGTLTDIEEETQIYVCDINPNMLNVGKKRASERGYKEGHCLSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKRGGRFLCLELSHVDVPLFKEIYDVYSFSVIPAVGELVAGDRQSYQYLVESIRRFPNQEKFAQMIQEAGFERVEYENLVGGVVAIHSGLKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry