Mouse Anti-COQ5 Antibody (CBMOAB-22310FYB)
Cat: CBMOAB-22310FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-22310FYB | Monoclonal | Rice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Maize (Zea mays), O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO22310FYB | 100 µg | ||
CBMOAB-26427FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO26427FC | 100 µg | ||
CBMOAB-13767FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO13767FYA | 100 µg | ||
CBMOAB-39737FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39737FYA | 100 µg | ||
CBMOAB-71341FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71341FYA | 100 µg | ||
CBMOAB-00793CR | Monoclonal | Yeast | WB, ELISA | MO00793CR | 100 µg | ||
CBMOAB-02095HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO02095HB | 100 µg | ||
MO-AB-02391W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02391W | 100 µg | ||
MO-AB-03553W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03553W | 100 µg | ||
MO-AB-10888W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10888W | 100 µg | ||
MO-AB-27495W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27495W | 100 µg | ||
MO-AB-34613W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34613W | 100 µg | ||
MO-AB-43022W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43022W | 100 µg | ||
MO-AB-47824W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47824W | 100 µg | ||
MO-AB-10587R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10587R | 100 µg | ||
MO-AB-01000H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO01000C | 100 µg | ||
MO-AB-01352Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01352Y | 100 µg | ||
MO-AB-11029Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11029Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Maize (Zea mays), O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) |
Clone | MO22310FYB |
Specificity | This antibody binds to Rice COQ5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | COQ5 (Coenzyme Q5, Methyltransferase) is a Protein Coding gene. Among its related pathways are Ubiquinol biosynthesis and Metabolism. Gene Ontology (GO) annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity. |
Product Overview | Mouse Anti-Rice COQ5 Antibody is a mouse antibody against COQ5. It can be used for COQ5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; EC 2.1.1.201; Ubiquinone biosynthesis methyltransferase COQ5; COQ5; Os01g0976600 LOC_Os01g74520 |
UniProt ID | Q5JNC0 |
Protein Refseq | The length of the protein is 294 amino acids long. The sequence is show below: MALRSAAGRLASSSRRRLLSPPTSIHTAFLHSHATSFGYKQVAEEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFPGMKHLDVAGGTGDVAFRALERINSVSHRAMQGTLTDIEEETQIYVCDINPNMLNVGKKRASERGYKEGHCLSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKRGGRFLCLELSHVDVPLFKEIYDVYSFSVIPAVGELVAGDRQSYQYLVESIRRFPNQEKFAQMIQEAGFERVEYENLVGGVVAIHSGLKL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry