Mouse Anti-Sheep COL1A2 Antibody (MO-AB-14676Y)


Cat: MO-AB-14676Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries)
CloneMO14676Y
SpecificityThis antibody binds to Sheep COL1A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the chains for type I collagen, the fibrillar collagen found in most connective tissues. Mutations in this gene are associated with osteogenesis imperfecta, Cardiac-valvular, and Arthrochlasia type Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome.
Product OverviewThis product is a mouse antibody against COL1A2. It can be used for COL1A2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOL1A2 protein; COL1A2
UniProt IDA9P555
Protein RefseqThe length of the protein is 61 amino acids long. The sequence is show below: YYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry