Mouse Anti-Sheep COL1A2 Antibody (MO-AB-14676Y)
Cat: MO-AB-14676Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO14676Y |
Specificity | This antibody binds to Sheep COL1A2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes one of the chains for type I collagen, the fibrillar collagen found in most connective tissues. Mutations in this gene are associated with osteogenesis imperfecta, Cardiac-valvular, and Arthrochlasia type Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. |
Product Overview | This product is a mouse antibody against COL1A2. It can be used for COL1A2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | COL1A2 protein; COL1A2 |
UniProt ID | A9P555 |
Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: YYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQ. |
See other products for " COL1A2 "
MO-AB-34182W | Mouse Anti-Donkey COL1A2 Antibody (MO-AB-34182W) |
CBMOAB-71175FYA | Mouse Anti-Zebrafish col1a2 Antibody (CBMOAB-71175FYA) |
CBMOAB-39632FYA | Mouse Anti-Rhesus COL1A2 Antibody (CBMOAB-39632FYA) |
MO-AB-01335Y | Mouse Anti-Chicken COL1A2 Antibody (MO-AB-01335Y) |
MO-AB-10511R | Mouse Anti-Cattle COL1A2 Antibody (MO-AB-10511R) |
MO-AB-36922W | Mouse Anti-Goat COL1A2 Antibody (MO-AB-36922W) |
MO-AB-44118W | Mouse Anti-Horse COL1A2 Antibody (MO-AB-44118W) |
MO-AB-32971H | Mouse Anti-Nile tilapia COL1A2 Antibody (MO-AB-32971H) |
MO-AB-07664Y | Mouse Anti-Rabbit COL1A2 Antibody (MO-AB-07664Y) |
MO-AB-24739R | Mouse Anti-Pig COL1A2 Antibody (MO-AB-24739R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry