Mouse Anti-A protein Antibody (MO-AB-34074H)


Cat: MO-AB-34074H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-34074H Monoclonal Tomato (Lycopersicon esculentum), Fruit fly (Drosophila melanogaster), Rice (Oryza) WB, ELISA MO34074C 100 µg
CBMOAB-00440FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO00440FYA 100 µg
CBMOAB-18446FYB Monoclonal Rice (Oryza) WB, ELISA MO18446FYB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityTomato (Lycopersicon esculentum), Fruit fly (Drosophila melanogaster), Rice (Oryza)
CloneMO34074C
SpecificityThis antibody binds to Tomato A protein.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against A protein. It can be used for A protein detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRipening regulated protein DDTFR10/A; A; DDTFR10
UniProt IDQ9FR33
Protein RefseqThe length of the protein is 214 amino acids long.
The sequence is show below: AAGRKPSLNISIPSVKKTEEPKTGEVKTGEPKTEEPKTGEVKTEYSVKEKMVENSEKKRYRGVRQRPWGKFAAEIRDPTRKGTRVWLGTFDTAMDAAMAYDRAAFRLRGSKAILNFPLEVSNFKQENHEIEKNVVNLNSNTNSCGKRVRREMENDDGIVMKKEVKREQMVATPLTPSNWSSIWDCGNGKGIFEVPPLSPLSPHSNFGYSQLLVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry