Mouse Anti-Yeast DPM1 Antibody (CBMOAB-01070CR)


Cat: CBMOAB-01070CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO01070CR
SpecificityThis antibody binds to Yeast DPM1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTransfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
Product OverviewMouse Anti-Yeast DPM1 (clone MO01070CR) Antibody (CBMOAB-01070CR) is a mouse antibody against DPM1. It can be used for DPM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDolichol-phosphate mannosyltransferase; EC 2.4.1.83; Dolichol-phosphate mannose synthase; DPM synthase; Dolichyl-phosphate beta-D-mannosyltransferase; Mannose-P-dolichol synthase; MPD synthase; DPM1; SED3; YPR183W
UniProt IDP14020
Protein RefseqThe length of the protein is 267 amino acids long. The sequence is show below: MSIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF.
For Research Use Only | Not For Clinical Use.

Online Inquiry