Mouse Anti-Yeast UBC8 Antibody (CBMOAB-00064CR)


Cat: CBMOAB-00064CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00064CR
SpecificityThis antibody binds to Yeast UBC8.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the covalent attachment of ubiquitin to other proteins (PubMed:1869573) (By similarity). Required for the adaptation to the presence of glucose in the growth medium; mediates the degradation of enzymes involved in gluconeogenesis when cells are shifted to glucose-containing medium (PubMed:9737955, PubMed:10811607, PubMed:12686616). Required for proteasome-dependent catabolite degradation of fructose-1,6-bisphosphatase (FBP1) (PubMed:9737955, PubMed:10811607, PubMed:12686616, PubMed:28126757).
Product OverviewMouse Anti-Yeast UBC8 (clone MO00064CR) Antibody (CBMOAB-00064CR) is a mouse antibody against UBC8. It can be used for UBC8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquitin-conjugating enzyme E2-24 kDa; EC 6.3.2.19; Glucose-induced degradation protein 3; Ubiquitin carrier protein; Ubiquitin-protein ligase; UBC8; GID3; YEL012W
UniProt IDP28263
Protein RefseqThe length of the protein is 218 amino acids long. The sequence is show below: MSSSKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYATKEKYQQMFGGDNDSDDSDSGGDLQEEDSDSDEDMDGTGVSSGDDSVDELSEDLSDIDVSDDDDYDEVANQ.
For Research Use Only | Not For Clinical Use.

Online Inquiry