Mouse Anti-ubald1 Antibody (CBMOAB-11433FYB)


Cat: CBMOAB-11433FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11433FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO11433FYB 100 µg
MO-AB-22478R Monoclonal Cattle (Bos taurus) WB, ELISA MO22478R 100 µg
MO-AB-29865H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29865C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO11433FYB
SpecificityThis antibody binds to Zebrafish ubald1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionUBALD1 (UBA Like Domain Containing 1) is a Protein Coding gene. An important paralog of this gene is UBALD2.
Product OverviewMouse Anti-Zebrafish ubald1 Antibody is a mouse antibody against ubald1. It can be used for ubald1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUBA-like domain-containing protein 1; ubald1; fam100a; NP_001002488.
UniProt IDQ6DGM1
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: MDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYGHHHQMMCTPANTPATPPNFPDALTMFSRLKASESFNSSSSPSMATSPPPPPVSWGMAPPMANQQSLWTQGPSAQQTHPPPGWPSAVNQQAASEQKASAAMEAER.
For Research Use Only | Not For Clinical Use.
Online Inquiry