Mouse Anti-ubald2 Antibody (CBMOAB-11444FYB)


Cat: CBMOAB-11444FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11444FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO11444FYB 100 µg
MO-AB-06794W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06794W 100 µg
MO-AB-24977W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24977W 100 µg
MO-AB-29866H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29866C 100 µg
MO-AB-67256W Monoclonal Marmoset WB, ELISA MO67256W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO11444FYB
SpecificityThis antibody binds to Zebrafish ubald2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionUBALD2 (UBA Like Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBALD1.
Product OverviewMouse Anti-Zebrafish ubald2 Antibody is a mouse antibody against ubald2. It can be used for ubald2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUBA-like domain-containing protein 2; ubald2; fam100
UniProt IDQ502A3
Protein RefseqThe length of the protein is 172 amino acids long.
The sequence is show below: MSVNMDELRHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSSFFQEANIPSHHQMMCTPRNTPATPPNFPDAITMFSKLRASECPGGGVSAGGGSSAQVSMACSPPHASFWASPPPNQQPVWLPPSSPTGHHTLHHHHHHMHPPPSWPPVSQPANGPQTPVISALHGQR.
For Research Use Only | Not For Clinical Use.
Online Inquiry