Mouse Anti-zbtb49 Antibody (CBMOAB-16702FYB)


Cat: CBMOAB-16702FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16702FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO16702FYB 100 µg
CBMOAB-62663FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62663FYA 100 µg
MO-AB-09450H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09450C 100 µg
MO-AB-15203W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15203W 100 µg
MO-AB-68126W Monoclonal Marmoset WB, ELISA MO68126W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO16702FYB
SpecificityThis antibody binds to Zebrafish zbtb49.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription factor. Inhibits cell proliferation by activating either CDKN1A/p21 transcription or RB1 transcription.
Product OverviewMouse Anti-Zebrafish zbtb49 Antibody is a mouse antibody against zbtb49. It can be used for zbtb49 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:158483 protein; zbtb49; zgc:15848
UniProt IDA2RUZ2
Protein RefseqThe length of the protein is 524 amino acids long.
The sequence is show below: MDSVSVHSVYVLQQLQEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSSYFRSLFQNSPAQKSDVFHLSIQDVSGIGQLLDYMYTSHLELNQENVHTLLEIGQSLQVLNVLNMCHAFLKPCVSADSASSCCVSAGPECVSGPGASEPQEPPHTHKLRSFYSRQYLQQSPAAGPAPSGPGAPQHKKTLYVKKFNYLRSQEEEEERCAGGHAPCGPATPSSADTTPSDLCVTSDLCVTPDLCVTSDPAEAAELERTPEAEPGNTGPQGQEQRSGVSGGGGNKYCCEVCGKTFKHPSNLELHKRSHTGEKPFQCSVCGKAFSQAGNLQTHLRRHSGEKPYICELCGKSFAASGDVQRHIIIHSGARPHLCDVCGRGFSNFSNLKEHKKTHRAEREFTCDQCGKSFNMQRKLLKHKSRHSGDKPYCCQTCGKCFAGSGDLQRHVRSHTGERPYVCDACGKSFSRTAVLRRHRSAGVCVSSTAAPECVCAPQRPGEVCVSSEAAPEPGPEELCSSGALWGRAMKTLQSDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry