Mouse Anti-zfand3 Antibody (CBMOAB-16842FYB)


Cat: CBMOAB-16842FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16842FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO16842FYB 100 µg
CBMOAB-62802FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62802FYA 100 µg
MO-AB-17502W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17502W 100 µg
MO-AB-23176R Monoclonal Cattle (Bos taurus) WB, ELISA MO23176R 100 µg
MO-AB-30095H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30095C 100 µg
MO-AB-68223W Monoclonal Marmoset WB, ELISA MO68223W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO16842FYB
SpecificityThis antibody binds to Zebrafish zfand3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionZFAND4 (Zinc Finger AN1-Type Containing 4) is a Protein Coding gene. An important paralog of this gene is UBA52.
Product OverviewMouse Anti-Zebrafish zfand3 Antibody is a mouse antibody against zfand3. It can be used for zfand3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:110105; zfand3; zgc:11010
UniProt IDQ4KMI6
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MGDTGSERSKPPSIPPRCPCGFWGSSKTMNLCSKCFADIQKKQPDEDCTPEPAPSSSNSQSAVFCNETSSSSSQTLSSKPASSEEPSTEATPLPAQDEVSSTDTARGTLSTPTKRPCDSASGSESESSPEKRVRVGEASCSEDSPRVPKQKNRRRCHRCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCMFDHLGRGREEAVLKMVKLDRKVGRTCQRIGEECS.
For Research Use Only | Not For Clinical Use.
Online Inquiry