Mouse Anti-adh2 Antibody (MO-AB-34114H)
Cat: MO-AB-34114H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-34114H | Monoclonal | Tomato (Lycopersicon esculentum), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Maize (Zea mays), Rice (Oryza), Yeast | WB, ELISA | MO34114C | 100 µg | ||
| CBMOAB-1660FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1660FC | 100 µg | ||
| CBMOAB-00129CR | Monoclonal | Yeast | WB, ELISA | MO00129CR | 100 µg | ||
| CBMOAB-18518FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18518FYB | 100 µg | ||
| MO-AB-38818W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO38818W | 100 µg | ||
| MO-AB-47216W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47216W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Tomato (Lycopersicon esculentum), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Maize (Zea mays), Rice (Oryza), Yeast |
| Clone | MO34114C |
| Specificity | This antibody binds to Tomato adh2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This isozyme preferentially catalyzes the conversion of ethanol to acetaldehyde. Acts on a variety of primary unbranched aliphatic alcohols. |
| Product Overview | This product is a mouse antibody against adh2. It can be used for adh2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Alcohol dehydrogenase; adh2 |
| UniProt ID | Q8GRT4 |
| Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: AVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWEAKGQNPVFPRILGHEAAG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry