Mouse Anti-ADIPOR1 Antibody (MO-AB-07054R)
Cat: MO-AB-07054R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-07054R | Monoclonal | Cattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus, Rice (Oryza), Sheep (Ovis aries) | WB, ELISA | MO07054R | 100 µg | ||
CBMOAB-00283FYA | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IF, IHC, FC | F00283FYA | 100 µg | ||
CBMOAB-18521FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18521FYB | 100 µg | ||
MO-AB-09161W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09161W | 100 µg | ||
MO-AB-24664W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24664W | 100 µg | ||
MO-AB-34336W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34336W | 100 µg | ||
MO-AB-36673W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36673W | 100 µg | ||
MO-AB-50500W | Monoclonal | Marmoset | WB, ELISA | MO50500W | 100 µg | ||
MO-AB-23569R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23569R | 100 µg | ||
MO-AB-01257H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01257C | 100 µg | ||
MO-AB-22813H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO22813C | 100 µg | ||
MO-AB-00057Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00057Y | 100 µg | ||
MO-AB-07093Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07093Y | 100 µg | ||
MO-AB-14094Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14094Y | 100 µg | ||
MO-NAB-00383W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, FC, IF, IHC, IHC-P | NW0308 | 100 µg | ||
MO-DKB-00943W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg | |||
MO-DKB-03602W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, FC, IHC-P, IF, IHC | ms2109-010 | 100 µg | ||
MOFY-0722-FY94 | Polyclonal | Rhesus | WB, IHC, ICC, IP | 100 µg | |||
MOFY-1222-FY124 | Polyclonal | Human, Mouse, Rat, Zebrafish | FC, IF, IHC, ICC, WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus, Rice (Oryza), Sheep (Ovis aries) |
Clone | MO07054R |
Specificity | This antibody binds to Cattle ADIPOR1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014] |
Product Overview | Mouse Anti-Cattle ADIPOR1 Antibody is a mouse antibody against ADIPOR1. It can be used for ADIPOR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adiponectin receptor 1; ADIPOR1 |
UniProt ID | Q3T0U4 |
Protein Refseq | The length of the protein is 375 amino acids long. The sequence is show below: MSSHKGPAVAQGNGAPASNRAADTVELAELGPLLEEKGKRAVTSPTKAEEEQACPGPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFRSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQW. |
For Research Use Only | Not For Clinical Use.
Online Inquiry