Mouse Anti-AHP1 Antibody (MO-AB-00056H)


Cat: MO-AB-00056H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00056H Monoclonal Arabidopsis (Arabidopsis lyrata), A. thaliana (Arabidopsis thaliana), Yeast WB, ELISA MO00056C 100 µg
CBMOAB-1931FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO1931FC 100 µg
CBMOAB-00162CR Monoclonal Yeast WB, ELISA MO00162CR 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityArabidopsis (Arabidopsis lyrata), A. thaliana (Arabidopsis thaliana), Yeast
CloneMO00056C
SpecificityThis antibody binds to Arabidopsis AHP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Preferentially eliminates organic peroxides rather than hydrogen peroxide (PubMed:10391912, PubMed:9988687, PubMed:10681558). Relays alkyl hydroperoxides as a signal to the transcription factor CAD1/YAP2 by inducing the formation of intramolecular disulfide bonds in CAD1, which causes its nuclear accumulation and activation (PubMed:20145245). Involved in cellular Mn homeostasis (PubMed:10635552).
Product OverviewThis product is a mouse antibody against AHP1. It can be used for AHP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistidine-containing phosphotransmitter 3; AHP1
UniProt IDD7L0T7
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: MDLVQMQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVELGF.
See other products for " AHP1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry