Mouse Anti-Arabidopsis AK1 Antibody (CBMOAB-0758FYC)
Cat: CBMOAB-0758FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO0758FC |
| Specificity | This antibody binds to Arabidopsis AK1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
| Product Overview | Mouse Anti-Arabidopsis AK1 Antibody is a mouse antibody against AK1. It can be used for AK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Adenylate Kinase 1; Adenylate Monophosphate Kinase; ATP-AMP Transphosphorylase 1; ATP:AMP Phosphotransferase; EC 2.7.4.3; Myokinase; Testis Secretory Sperm Binding Protein Li 58j |
| UniProt ID | Q38974 |
| Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: KPSNVLLDQDMVPKISDFGMSKLFDKRAAAANTTKIVGTYGYMSPEYAEEGIYSSKS. |
See other products for " AK1 "
| MO-AB-14147Y | Mouse Anti-Sheep AK1 Antibody (MO-AB-14147Y) |
| MO-AB-24012H | Mouse Anti-Rat Ak1 Antibody (MO-AB-24012H) |
| MO-AB-10612Y | Mouse Anti-O. mykiss AK1 Antibody (MO-AB-10612Y) |
| MO-AB-15852W | Mouse Anti-Chimpanzee AK1 Antibody (MO-AB-15852W) |
| MO-AB-38435W | Mouse Anti-Gorilla AK1 Antibody (MO-AB-38435W) |
| CBMOAB-65342FYA | Mouse Anti-Zebrafish ak1 Antibody (CBMOAB-65342FYA) |
| MO-AB-01317H | Mouse Anti-Frog ak1 Antibody (MO-AB-01317H) |
| MO-AB-07128Y | Mouse Anti-Rabbit AK1 Antibody (MO-AB-07128Y) |
| MO-AB-50634W | Mouse Anti-Marmoset AK1 Antibody (MO-AB-50634W) |
| MO-AB-07173R | Mouse Anti-Cattle AK1 Antibody (MO-AB-07173R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry