Mouse Anti-Arabidopsis AK1 Antibody (CBMOAB-0758FYC)

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details


Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
SpecificityThis antibody binds to Arabidopsis AK1.
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.


IntroductionThis gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Arabidopsis AK1 (clone MO0758FC) Antibody (CBMOAB-0758FYC) is a mouse antibody against AK1. It can be used for AK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate Kinase 1; Adenylate Monophosphate Kinase; ATP-AMP Transphosphorylase 1; ATP:AMP Phosphotransferase; EC; Myokinase; Testis Secretory Sperm Binding Protein Li 58j
UniProt IDQ38974
Protein RefseqThe length of the protein is 57 amino acids long. The sequence is show below: KPSNVLLDQDMVPKISDFGMSKLFDKRAAAANTTKIVGTYGYMSPEYAEEGIYSSKS.
For Research Use Only | Not For Clinical Use.

Online Inquiry